| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) ![]() not a true superfamily |
| Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein) beta-hairpin and a short alpha-helix bound to the core subunits |
| Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop Uniprot P13272 1-57 ! Uniprot P13272 |
| Domain d1ntmi_: 1ntm I: [92134] Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmj_, d1ntmk_ complexed with fes, hem |
PDB Entry: 1ntm (more details), 2.4 Å
SCOPe Domain Sequences for d1ntmi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntmi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
Timeline for d1ntmi_: