Lineage for d1ntmf_ (1ntm F:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426780Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 426781Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 426782Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 426783Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 426794Species Cow (Bos taurus) [TaxId:9913] [81519] (9 PDB entries)
  8. 426798Domain d1ntmf_: 1ntm F: [92131]
    Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
    complexed with fes, hem

Details for d1ntmf_

PDB Entry: 1ntm (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom
PDB Compounds: (F:)

SCOP Domain Sequences for d1ntmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntmf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOP Domain Coordinates for d1ntmf_:

Click to download the PDB-style file with coordinates for d1ntmf_.
(The format of our PDB-style files is described here.)

Timeline for d1ntmf_: