SCOP 1.67: Domain d1ntmd1: 1ntm D:1-195

Lineage for d1ntmd1 (1ntm D:1-195)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (9 PDB entries)

8. Domain d1ntmd1: 1ntm D:1-195 [92127]
   Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
   complexed with fes, hem

Details for d1ntmd1

PDB Entry: 1ntm, 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

SCOP Domain Sequences for d1ntmd1:

Sequence; same for both SEQRES and ATOM records:

>d1ntmd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus)}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d1ntmd1:

• d1ntmd1 is new in SCOP 1.67
  
• d1ntmd1 appears in SCOP 1.69
  
• d1ntmd1 appears in the current release, SCOPe 2.08