Lineage for d1ntkj_ (1ntk J:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254512Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2254513Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2254514Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 2254525Species Cow (Bos taurus) [TaxId:9913] [81509] (19 PDB entries)
    Uniprot P00130
  8. 2254537Domain d1ntkj_: 1ntk J: [92119]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntkj_

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d1ntkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen

SCOPe Domain Coordinates for d1ntkj_:

Click to download the PDB-style file with coordinates for d1ntkj_.
(The format of our PDB-style files is described here.)

Timeline for d1ntkj_: