Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) location - intermembrane side of the bc1 complex |
Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81526] (12 PDB entries) |
Domain d1ntkh_: 1ntk H: [92117] Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntki_, d1ntkj_, d1ntkk_ complexed with ay1, fes, hem |
PDB Entry: 1ntk (more details), 2.6 Å
SCOP Domain Sequences for d1ntkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntkh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)} pkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldfl hardhcvahklfnslk
Timeline for d1ntkh_: