Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries) Uniprot P13271 #SP Uniprot P13271 Uniprot P13271 #SP ! Uniprot P13271 |
Domain d1ntkg_: 1ntk G: [92116] Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_ complexed with ay1, fes, hem |
PDB Entry: 1ntk (more details), 2.6 Å
SCOP Domain Sequences for d1ntkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntkg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpaayen
Timeline for d1ntkg_: