Lineage for d1ntke1 (1ntk E:70-196)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1782958Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1782980Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 1782996Species Cow (Bos taurus) [TaxId:9913] [50025] (18 PDB entries)
  8. 1783009Domain d1ntke1: 1ntk E:70-196 [92113]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntke1

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1ntke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntke1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1ntke1:

Click to download the PDB-style file with coordinates for d1ntke1.
(The format of our PDB-style files is described here.)

Timeline for d1ntke1: