SCOP 1.75: Domain d1ntfa_: 1ntf A:

Lineage for d1ntfa_ (1ntf A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (3 families)

5. Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (2 proteins)

6. Protein Salivary nitrophorin [103310] (1 species)
   heme-binding homologue of IPP5

7. Species Bedbug (Cimex lectularius) [TaxId:79782] [103311] (5 PDB entries)
   SQ O7674 23-302

8. Domain d1ntfa_: 1ntf A: [92104]
   complexed with hem

Details for d1ntfa_

PDB Entry: 1ntf, 1.8 Å

PDB Description: Crystal Structure of Cimex Nitrophorin

PDB Compounds: (A:) Salivary nitrophorin

SCOP Domain Sequences for d1ntfa_:

Sequence; same for both SEQRES and ATOM records:

>d1ntfa_ d.151.1.2 (A:) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

Timeline for d1ntfa_:

• d1ntfa_ first appeared in SCOP 1.67
  
• d1ntfa_ appears in SCOP 1.73
  
• d1ntfa_ appears in SCOPe 2.01
  
• d1ntfa_ appears in the current release, SCOPe 2.08