Lineage for d1ns9b_ (1ns9 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531125Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries)
  8. 531151Domain d1ns9b_: 1ns9 B: [92096]
    Other proteins in same PDB: d1ns9a_
    complexed with hem

Details for d1ns9b_

PDB Entry: 1ns9 (more details), 1.6 Å

PDB Description: the 1.6a structure of horse methemoglobin at ph 7.1

SCOP Domain Sequences for d1ns9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns9b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOP Domain Coordinates for d1ns9b_:

Click to download the PDB-style file with coordinates for d1ns9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ns9b_: