SCOP 1.73: Domain d1ns9a_: 1ns9 A:

Lineage for d1ns9a_ (1ns9 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)

8. Domain d1ns9a_: 1ns9 A: [92095]
   Other proteins in same PDB: d1ns9b_
   complexed with hem

Details for d1ns9a_

PDB Entry: 1ns9, 1.6 Å

PDB Description: the 1.6a structure of horse methemoglobin at ph 7.1

PDB Compounds: (A:) Hemoglobin alpha subunit

SCOP Domain Sequences for d1ns9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ns9a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d1ns9a_:

• d1ns9a_ first appeared in SCOP 1.67
  
• d1ns9a_ appears in SCOP 1.71
  
• d1ns9a_ appears in SCOP 1.75
  
• d1ns9a_ appears in the current release, SCOPe 2.08