Lineage for d1ns6b_ (1ns6 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349705Protein Hemoglobin, beta-chain [46500] (19 species)
  7. 349759Species Human (Homo sapiens) [TaxId:9606] [46501] (114 PDB entries)
  8. 349853Domain d1ns6b_: 1ns6 B: [92094]
    Other proteins in same PDB: d1ns6a_
    complexed with hem

Details for d1ns6b_

PDB Entry: 1ns6 (more details), 2.05 Å

PDB Description: the 2.1a structure of horse (alpha hemichrome/beta met) hemoglobin at ph 5.4

SCOP Domain Sequences for d1ns6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns6b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOP Domain Coordinates for d1ns6b_:

Click to download the PDB-style file with coordinates for d1ns6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ns6b_: