Lineage for d1ns6a_ (1ns6 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716172Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries)
  8. 1716178Domain d1ns6a_: 1ns6 A: [92093]
    Other proteins in same PDB: d1ns6b_
    complexed with hem

Details for d1ns6a_

PDB Entry: 1ns6 (more details), 2.05 Å

PDB Description: the 2.1a structure of horse (alpha hemichrome/beta met) hemoglobin at ph 5.4
PDB Compounds: (A:) Hemoglobin alpha subunit

SCOPe Domain Sequences for d1ns6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns6a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d1ns6a_:

Click to download the PDB-style file with coordinates for d1ns6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ns6a_: