SCOP 1.67: Domain d1ns6a_: 1ns6 A:

Lineage for d1ns6a_ (1ns6 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (17 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (114 PDB entries)

8. Domain d1ns6a_: 1ns6 A: [92093]
   Other proteins in same PDB: d1ns6b_
   complexed with hem

Details for d1ns6a_

PDB Entry: 1ns6, 2.05 Å

PDB Description: the 2.1a structure of horse (alpha hemichrome/beta met) hemoglobin at ph 5.4

SCOP Domain Sequences for d1ns6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ns6a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d1ns6a_:

• d1ns6a_ is new in SCOP 1.67
  
• d1ns6a_ appears in SCOP 1.69
  
• d1ns6a_ appears in the current release, SCOPe 2.08