| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries) |
| Domain d1ns6a_: 1ns6 A: [92093] Other proteins in same PDB: d1ns6b_ complexed with hem |
PDB Entry: 1ns6 (more details), 2.05 Å
SCOPe Domain Sequences for d1ns6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ns6a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr
Timeline for d1ns6a_: