Lineage for d1nrla_ (1nrl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009172Protein Pregnane x receptor, PXR [63624] (1 species)
  7. 2009173Species Human (Homo sapiens) [TaxId:9606] [63625] (16 PDB entries)
  8. 2009174Domain d1nrla_: 1nrl A: [92091]
    complexed with an src-1 coactivator peptide and sr12813
    complexed with srl

Details for d1nrla_

PDB Entry: 1nrl (more details), 2 Å

PDB Description: Crystal Structure of the human PXR-LBD in complex with an SRC-1 coactivator peptide and SR12813
PDB Compounds: (A:) orphan nuclear receptor pxr

SCOPe Domain Sequences for d1nrla_:

Sequence, based on SEQRES records: (download)

>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapsreeaakwsq
vrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvi
syfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqllle
pmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnr
pqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgitg

Sequence, based on observed residues (ATOM records): (download)

>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvsreeaakwsqvrkdlcslkvslql
rgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisl
lkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhymlkklql
heeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkima
mltelrsinaqhtqrllriqdihpfatplmqelfgitg

SCOPe Domain Coordinates for d1nrla_:

Click to download the PDB-style file with coordinates for d1nrla_.
(The format of our PDB-style files is described here.)

Timeline for d1nrla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nrlb_