Lineage for d1nrka2 (1nrk A:1-243)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240991Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 2240992Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 2240993Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 2241008Protein Hypothetical protein YgfZ, N-terminal domain [103029] (1 species)
  7. 2241009Species Escherichia coli [TaxId:562] [103030] (2 PDB entries)
    Uniprot P39179
  8. 2241011Domain d1nrka2: 1nrk A:1-243 [92090]
    Other proteins in same PDB: d1nrka1
    structural genomics
    complexed with so4

Details for d1nrka2

PDB Entry: 1nrk (more details), 2.8 Å

PDB Description: ygfz protein
PDB Compounds: (A:) YGFZ Protein

SCOPe Domain Sequences for d1nrka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nrka2 d.250.1.1 (A:1-243) Hypothetical protein YgfZ, N-terminal domain {Escherichia coli [TaxId: 562]}
maftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtadvsqmaedqhlla
ahcdakgkmwsnlrlfrdgdgfawierrsvrepqltelkkyavfskvtiapddervllgv
agfqaraalanlfselpskekqvvkegattllwfehpaerflivtdeatanmltdklrge
aelnnsqqwlalnieagfpvidaansgqfipqatnlqalggisfkkgcytgqemvarakf
rga

SCOPe Domain Coordinates for d1nrka2:

Click to download the PDB-style file with coordinates for d1nrka2.
(The format of our PDB-style files is described here.)

Timeline for d1nrka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nrka1