![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.250: Folate-binding domain [103024] (1 superfamily) duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands |
![]() | Superfamily d.250.1: Folate-binding domain [103025] (2 families) ![]() some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase |
![]() | Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins) |
![]() | Protein Hypothetical protein YgfZ, N-terminal domain [103029] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103030] (2 PDB entries) Uniprot P39179 |
![]() | Domain d1nrka2: 1nrk A:1-243 [92090] Other proteins in same PDB: d1nrka1 structural genomics complexed with so4 |
PDB Entry: 1nrk (more details), 2.8 Å
SCOPe Domain Sequences for d1nrka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrka2 d.250.1.1 (A:1-243) Hypothetical protein YgfZ, N-terminal domain {Escherichia coli [TaxId: 562]} maftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtadvsqmaedqhlla ahcdakgkmwsnlrlfrdgdgfawierrsvrepqltelkkyavfskvtiapddervllgv agfqaraalanlfselpskekqvvkegattllwfehpaerflivtdeatanmltdklrge aelnnsqqwlalnieagfpvidaansgqfipqatnlqalggisfkkgcytgqemvarakf rga
Timeline for d1nrka2: