![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.9: IL8-like [54116] (1 superfamily) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins) |
![]() | Protein Thymus and activation-regulated chemokine, TRAC [102730] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102731] (2 PDB entries) |
![]() | Domain d1nr4h_: 1nr4 H: [92084] complexed with so4 |
PDB Entry: 1nr4 (more details), 1.72 Å
SCOP Domain Sequences for d1nr4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nr4h_ d.9.1.1 (H:) Thymus and activation-regulated chemokine, TRAC {Human (Homo sapiens)} reccleyfkgaiplrklktwyqtsedcsrdaivfvtvqgraicsdpnnkrvknavkylqs ler
Timeline for d1nr4h_: