Lineage for d1nr4g_ (1nr4 G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536144Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2536456Protein Thymus and activation-regulated chemokine, TRAC [102730] (1 species)
  7. 2536457Species Human (Homo sapiens) [TaxId:9606] [102731] (2 PDB entries)
  8. 2536464Domain d1nr4g_: 1nr4 G: [92083]
    complexed with so4

Details for d1nr4g_

PDB Entry: 1nr4 (more details), 1.72 Å

PDB Description: high resolution crystal structures of thymus and activation-regulated chemokine
PDB Compounds: (G:) Thymus and activation-regulated chemokine

SCOPe Domain Sequences for d1nr4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr4g_ d.9.1.1 (G:) Thymus and activation-regulated chemokine, TRAC {Human (Homo sapiens) [TaxId: 9606]}
gtnvgreccleyfkgaiplrklktwyqtsedcsrdaivfvtvqgraicsdpnnkrvknav
kylqsl

SCOPe Domain Coordinates for d1nr4g_:

Click to download the PDB-style file with coordinates for d1nr4g_.
(The format of our PDB-style files is described here.)

Timeline for d1nr4g_: