Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein Thymus and activation-regulated chemokine, TRAC [102730] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102731] (2 PDB entries) |
Domain d1nr4g_: 1nr4 G: [92083] complexed with so4 |
PDB Entry: 1nr4 (more details), 1.72 Å
SCOPe Domain Sequences for d1nr4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nr4g_ d.9.1.1 (G:) Thymus and activation-regulated chemokine, TRAC {Human (Homo sapiens) [TaxId: 9606]} gtnvgreccleyfkgaiplrklktwyqtsedcsrdaivfvtvqgraicsdpnnkrvknav kylqsl
Timeline for d1nr4g_: