Lineage for d1nr4d_ (1nr4 D:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407213Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 407214Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 407215Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 407405Protein Thymus and activation-regulated chemokine, TRAC [102730] (1 species)
  7. 407406Species Human (Homo sapiens) [TaxId:9606] [102731] (2 PDB entries)
  8. 407410Domain d1nr4d_: 1nr4 D: [92080]

Details for d1nr4d_

PDB Entry: 1nr4 (more details), 1.72 Å

PDB Description: high resolution crystal structures of thymus and activation-regulated chemokine

SCOP Domain Sequences for d1nr4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr4d_ d.9.1.1 (D:) Thymus and activation-regulated chemokine, TRAC {Human (Homo sapiens)}
greccleyfkgaiplrklktwyqtsedcsrdaivfvtvqgraicsdpnnkrvknavkylq
sle

SCOP Domain Coordinates for d1nr4d_:

Click to download the PDB-style file with coordinates for d1nr4d_.
(The format of our PDB-style files is described here.)

Timeline for d1nr4d_: