Lineage for d1nr2a_ (1nr2 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499235Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2499540Protein Thymus and activation-regulated chemokine, TRAC [102730] (1 species)
  7. 2499541Species Human (Homo sapiens) [TaxId:9606] [102731] (2 PDB entries)
  8. 2499550Domain d1nr2a_: 1nr2 A: [92075]

Details for d1nr2a_

PDB Entry: 1nr2 (more details), 2.18 Å

PDB Description: high resolution crystal structures of thymus and activation-regulated chemokine
PDB Compounds: (A:) Thymus and activation-regulated chemokine

SCOPe Domain Sequences for d1nr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr2a_ d.9.1.1 (A:) Thymus and activation-regulated chemokine, TRAC {Human (Homo sapiens) [TaxId: 9606]}
reccleyfkgaiplrklktwyqtsedcsrdaivfvtvqgraicsdpnnkrvknavkylqs
le

SCOPe Domain Coordinates for d1nr2a_:

Click to download the PDB-style file with coordinates for d1nr2a_.
(The format of our PDB-style files is described here.)

Timeline for d1nr2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nr2b_