![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
![]() | Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
![]() | Protein Lumazine synthase [52123] (7 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries) |
![]() | Domain d1nqxe_: 1nqx E: [92074] complexed with po4, rlp |
PDB Entry: 1nqx (more details), 1.82 Å
SCOPe Domain Sequences for d1nqxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqxe_ c.16.1.1 (E:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]} mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt leqaieragtkhgnkgweaalsaiemanlfkslr
Timeline for d1nqxe_:
![]() Domains from other chains: (mouse over for more information) d1nqxa_, d1nqxb_, d1nqxc_, d1nqxd_ |