Lineage for d1nqxd_ (1nqx D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390503Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 390504Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 390505Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 390506Protein Lumazine synthase [52123] (7 species)
  7. 390507Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries)
  8. 390521Domain d1nqxd_: 1nqx D: [92073]

Details for d1nqxd_

PDB Entry: 1nqx (more details), 1.82 Å

PDB Description: Crystal Structure of Lumazine Synthase from Aquifex aeolicus in Complex with Inhibitor: 3-(7-hydroxy-8-ribityllumazine-6-yl)propionic acid

SCOP Domain Sequences for d1nqxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqxd_ c.16.1.1 (D:) Lumazine synthase {Aquifex aeolicus}
mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip
vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt
leqaieragtkhgnkgweaalsaiemanlfkslr

SCOP Domain Coordinates for d1nqxd_:

Click to download the PDB-style file with coordinates for d1nqxd_.
(The format of our PDB-style files is described here.)

Timeline for d1nqxd_: