Lineage for d1nqxb_ (1nqx B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113861Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113862Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2113863Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2113864Protein Lumazine synthase [52123] (7 species)
  7. 2113865Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries)
  8. 2113877Domain d1nqxb_: 1nqx B: [92071]
    complexed with po4, rlp

Details for d1nqxb_

PDB Entry: 1nqx (more details), 1.82 Å

PDB Description: Crystal Structure of Lumazine Synthase from Aquifex aeolicus in Complex with Inhibitor: 3-(7-hydroxy-8-ribityllumazine-6-yl)propionic acid
PDB Compounds: (B:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1nqxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqxb_ c.16.1.1 (B:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]}
mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip
vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt
leqaieragtkhgnkgweaalsaiemanlfkslr

SCOPe Domain Coordinates for d1nqxb_:

Click to download the PDB-style file with coordinates for d1nqxb_.
(The format of our PDB-style files is described here.)

Timeline for d1nqxb_: