Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein Lumazine synthase [52123] (7 species) |
Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries) |
Domain d1nqwd_: 1nqw D: [92068] complexed with 5yl |
PDB Entry: 1nqw (more details), 2.2 Å
SCOPe Domain Sequences for d1nqwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqwd_ c.16.1.1 (D:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]} mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt leqaieragtkhgnkgweaalsaiemanlfkslr
Timeline for d1nqwd_:
View in 3D Domains from other chains: (mouse over for more information) d1nqwa_, d1nqwb_, d1nqwc_, d1nqwe_ |