Lineage for d1nqvd_ (1nqv D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113861Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113862Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2113863Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2113864Protein Lumazine synthase [52123] (7 species)
  7. 2113865Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries)
  8. 2113884Domain d1nqvd_: 1nqv D: [92063]
    complexed with lmz, po4

Details for d1nqvd_

PDB Entry: 1nqv (more details), 2.05 Å

PDB Description: Crystal Structure of Lumazine Synthase from Aquifex aeolicus in Complex with Inhibitor: 5-nitroso-6-ribityl-amino-2,4(1H,3H)pyrimidinedione
PDB Compounds: (D:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1nqvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqvd_ c.16.1.1 (D:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]}
mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip
vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt
leqaieragtkhgnkgweaalsaiemanlfkslr

SCOPe Domain Coordinates for d1nqvd_:

Click to download the PDB-style file with coordinates for d1nqvd_.
(The format of our PDB-style files is described here.)

Timeline for d1nqvd_: