Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
Protein Lumazine synthase [52123] (7 species) |
Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries) |
Domain d1nqvd_: 1nqv D: [92063] |
PDB Entry: 1nqv (more details), 2.05 Å
SCOP Domain Sequences for d1nqvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqvd_ c.16.1.1 (D:) Lumazine synthase {Aquifex aeolicus} mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt leqaieragtkhgnkgweaalsaiemanlfkslr
Timeline for d1nqvd_:
View in 3D Domains from other chains: (mouse over for more information) d1nqva_, d1nqvb_, d1nqvc_, d1nqve_ |