Lineage for d1nqvb_ (1nqv B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390503Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 390504Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 390505Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 390506Protein Lumazine synthase [52123] (7 species)
  7. 390507Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries)
  8. 390524Domain d1nqvb_: 1nqv B: [92061]

Details for d1nqvb_

PDB Entry: 1nqv (more details), 2.05 Å

PDB Description: Crystal Structure of Lumazine Synthase from Aquifex aeolicus in Complex with Inhibitor: 5-nitroso-6-ribityl-amino-2,4(1H,3H)pyrimidinedione

SCOP Domain Sequences for d1nqvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqvb_ c.16.1.1 (B:) Lumazine synthase {Aquifex aeolicus}
mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip
vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt
leqaieragtkhgnkgweaalsaiemanlfkslr

SCOP Domain Coordinates for d1nqvb_:

Click to download the PDB-style file with coordinates for d1nqvb_.
(The format of our PDB-style files is described here.)

Timeline for d1nqvb_: