Lineage for d1nqud_ (1nqu D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480690Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 480691Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 480692Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 480693Protein Lumazine synthase [52123] (7 species)
  7. 480694Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries)
  8. 480698Domain d1nqud_: 1nqu D: [92058]

Details for d1nqud_

PDB Entry: 1nqu (more details), 1.75 Å

PDB Description: Crystal Structure of Lumazine Synthase from Aquifex aeolicus in Complex with Inhibitor: 6,7-dioxo-5H-8-ribitylaminolumazine

SCOP Domain Sequences for d1nqud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqud_ c.16.1.1 (D:) Lumazine synthase {Aquifex aeolicus}
mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip
vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt
leqaieragtkhgnkgweaalsaiemanlfkslr

SCOP Domain Coordinates for d1nqud_:

Click to download the PDB-style file with coordinates for d1nqud_.
(The format of our PDB-style files is described here.)

Timeline for d1nqud_: