Lineage for d1nq6a_ (1nq6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819321Protein Xylanase A, catalytic core [51514] (8 species)
  7. 1819364Species Streptomyces halstedii [TaxId:1944] [102070] (1 PDB entry)
  8. 1819365Domain d1nq6a_: 1nq6 A: [92046]
    complexed with mg

Details for d1nq6a_

PDB Entry: 1nq6 (more details), 1.78 Å

PDB Description: Crystal Structure of the catalytic domain of xylanase A from Streptomyces halstedii JM8
PDB Compounds: (A:) Xys1

SCOPe Domain Sequences for d1nq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]}
agalgdaaaakgryfgaavaanhlgeaayastldaqfgsvtpenemkwdavessrnsfsf
saadrivshaqskgmkvrghtlvwhsqlpgwvsplaatdlrsamnnhitqvmthykgkih
swdvvneafqdggsgarrsspfqdklgngfieeafrtartvdadaklcyndyntdgqnak
snavyemvkdfkqrgvpidcvgfqshfnsnspvpsdfqanlqrfadlgvdvqiteldieg
sgsaqaanytkvvnaclavtrctgitvwgvtdkyswrsggtpllfdgdynkkpaydavla
al

SCOPe Domain Coordinates for d1nq6a_:

Click to download the PDB-style file with coordinates for d1nq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1nq6a_: