Lineage for d1nq6a_ (1nq6 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 385002Protein Xylanase A, catalytic core [51514] (7 species)
  7. 385029Species Streptomyces halstedii [TaxId:1944] [102070] (1 PDB entry)
  8. 385030Domain d1nq6a_: 1nq6 A: [92046]
    complexed with mg

Details for d1nq6a_

PDB Entry: 1nq6 (more details), 1.78 Å

PDB Description: Crystal Structure of the catalytic domain of xylanase A from Streptomyces halstedii JM8

SCOP Domain Sequences for d1nq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii}
agalgdaaaakgryfgaavaanhlgeaayastldaqfgsvtpenemkwdavessrnsfsf
saadrivshaqskgmkvrghtlvwhsqlpgwvsplaatdlrsamnnhitqvmthykgkih
swdvvneafqdggsgarrsspfqdklgngfieeafrtartvdadaklcyndyntdgqnak
snavyemvkdfkqrgvpidcvgfqshfnsnspvpsdfqanlqrfadlgvdvqiteldieg
sgsaqaanytkvvnaclavtrctgitvwgvtdkyswrsggtpllfdgdynkkpaydavla
al

SCOP Domain Coordinates for d1nq6a_:

Click to download the PDB-style file with coordinates for d1nq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1nq6a_: