SCOPe 2.06: Domain d1nq3e_: 1nq3 E:

Lineage for d1nq3e_ (1nq3 E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (3 species)
   mammalian tumor associated antigen UK114

7. Species Goat (Capra hircus) [TaxId:9925] [103077] (1 PDB entry)

8. Domain d1nq3e_: 1nq3 E: [92043]

Details for d1nq3e_

PDB Entry: 1nq3, 2.2 Å

PDB Description: Crystal structure of the mammalian tumor associated antigen UK114

PDB Compounds: (E:) 14.3 kDa perchloric acid soluble protein

SCOPe Domain Sequences for d1nq3e_:

Sequence; same for both SEQRES and ATOM records:

>d1nq3e_ d.79.1.1 (E:) 14.5 kda translational inhibitor protein, L-PSP {Goat (Capra hircus) [TaxId: 9925]}
sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
eieaiavqgpltt

Timeline for d1nq3e_:

• d1nq3e_ first appeared in SCOP 1.67
  
• d1nq3e_ appears in SCOPe 2.05
  
• d1nq3e_ appears in SCOPe 2.07
  
• d1nq3e_ appears in the current release, SCOPe 2.08