Lineage for d1nq3e_ (1nq3 E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525086Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2525087Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2525088Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (3 species)
    mammalian tumor associated antigen UK114
  7. 2525089Species Goat (Capra hircus) [TaxId:9925] [103077] (1 PDB entry)
  8. 2525094Domain d1nq3e_: 1nq3 E: [92043]

Details for d1nq3e_

PDB Entry: 1nq3 (more details), 2.2 Å

PDB Description: Crystal structure of the mammalian tumor associated antigen UK114
PDB Compounds: (E:) 14.3 kDa perchloric acid soluble protein

SCOPe Domain Sequences for d1nq3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nq3e_ d.79.1.1 (E:) 14.5 kda translational inhibitor protein, L-PSP {Goat (Capra hircus) [TaxId: 9925]}
sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
eieaiavqgpltt

SCOPe Domain Coordinates for d1nq3e_:

Click to download the PDB-style file with coordinates for d1nq3e_.
(The format of our PDB-style files is described here.)

Timeline for d1nq3e_: