Lineage for d1nq3c_ (1nq3 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (3 species)
    mammalian tumor associated antigen UK114
  7. Species Goat (Capra hircus) [TaxId:9925] [103077] (1 PDB entry)
  8. Domain d1nq3c_: 1nq3 C: [92041]

Details for d1nq3c_

PDB Entry: 1nq3 (more details), 2.2 Å

PDB Description: Crystal structure of the mammalian tumor associated antigen UK114
PDB Compounds: (C:) 14.3 kDa perchloric acid soluble protein

SCOPe Domain Sequences for d1nq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nq3c_ d.79.1.1 (C:) 14.5 kda translational inhibitor protein, L-PSP {Goat (Capra hircus) [TaxId: 9925]}
sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
eieaiavqgpltt

SCOPe Domain Coordinates for d1nq3c_ are not available.

Timeline for d1nq3c_:

Domains from other chains:
(mouse over for more information)
d1nq3a_, d1nq3b_, d1nq3d_, d1nq3e_, d1nq3f_