SCOP 1.69: Domain d1nq3a_: 1nq3 A:

Lineage for d1nq3a_ (1nq3 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (2 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (5 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (3 species)
   mammalian tumor associated antigen UK114

7. Species Goat (Capra hircus) [TaxId:9925] [103077] (1 PDB entry)

8. Domain d1nq3a_: 1nq3 A: [92039]

Details for d1nq3a_

PDB Entry: 1nq3, 2.2 Å

PDB Description: Crystal structure of the mammalian tumor associated antigen UK114

SCOP Domain Sequences for d1nq3a_:

Sequence; same for both SEQRES and ATOM records:

>d1nq3a_ d.79.1.1 (A:) 14.5 kda translational inhibitor protein, L-PSP {Goat (Capra hircus)}
slvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltni
geilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrve
ieaiavqgpltta

Timeline for d1nq3a_:

• d1nq3a_ first appeared in SCOP 1.67
  
• d1nq3a_ appears in SCOP 1.71
  
• d1nq3a_ appears in the current release, SCOPe 2.08