Lineage for d1npga_ (1npg A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717381Species Horse (Equus caballus) [TaxId:9796] [46474] (80 PDB entries)
  8. 1717427Domain d1npga_: 1npg A: [92037]
    complexed with hem, noe, so4

Details for d1npga_

PDB Entry: 1npg (more details), 1.7 Å

PDB Description: myoglobin (horse heart) wild-type complexed with nitrosoethane
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1npga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npga_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d1npga_:

Click to download the PDB-style file with coordinates for d1npga_.
(The format of our PDB-style files is described here.)

Timeline for d1npga_: