SCOPe 2.04: Domain d1npga_: 1npg A:

Lineage for d1npga_ (1npg A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (65 PDB entries)

8. Domain d1npga_: 1npg A: [92037]
   complexed with hem, noe, so4

Details for d1npga_

PDB Entry: 1npg, 1.7 Å

PDB Description: myoglobin (horse heart) wild-type complexed with nitrosoethane

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1npga_:

Sequence; same for both SEQRES and ATOM records:

>d1npga_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d1npga_:

• d1npga_ first appeared in SCOP 1.67
  
• d1npga_ appears in SCOPe 2.03
  
• d1npga_ appears in SCOPe 2.05
  
• d1npga_ appears in the current release, SCOPe 2.08