Lineage for d1npeb1 (1npe B:736-792)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 890004Family g.3.11.2: Laminin-type module [57233] (1 protein)
  6. 890005Protein Laminin gamma1 chain [57234] (1 species)
  7. 890006Species Mouse (Mus musculus) [TaxId:10090] [57235] (3 PDB entries)
  8. 890010Domain d1npeb1: 1npe B:736-792 [92033]
    Other proteins in same PDB: d1npea_

Details for d1npeb1

PDB Entry: 1npe (more details), 2.3 Å

PDB Description: Crystal structure of Nidogen/Laminin Complex
PDB Compounds: (B:) Laminin gamma-1 chain

SCOP Domain Sequences for d1npeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npeb1 g.3.11.2 (B:736-792) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}
qpcpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrp

SCOP Domain Coordinates for d1npeb1:

Click to download the PDB-style file with coordinates for d1npeb1.
(The format of our PDB-style files is described here.)

Timeline for d1npeb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1npea_