Lineage for d1npea_ (1npe A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468803Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 468981Superfamily b.68.5: YWTD domain [63825] (1 family) (S)
  5. 468982Family b.68.5.1: YWTD domain [63826] (2 proteins)
  6. 468988Protein Nidogen [101893] (1 species)
  7. 468989Species Mouse (Mus musculus) [TaxId:10090] [101894] (1 PDB entry)
  8. 468990Domain d1npea_: 1npe A: [92032]
    Other proteins in same PDB: d1npeb1, d1npeb2, d1npeb3

Details for d1npea_

PDB Entry: 1npe (more details), 2.3 Å

PDB Description: Crystal structure of Nidogen/Laminin Complex

SCOP Domain Sequences for d1npea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus)}
gthllfaqtgkierlplerntmkkteakaflhipakviiglafdcvdkvvywtdisepsi
graslhggepttiirqdlgspegialdhlgrtifwtdsqldrievakmdgtqrrvlfdtg
lvnprgivtdpvrgnlywtdwnrdnpkietshmdgtnrrilaqdnlglpngltfdafssq
lcwvdagthraeclnpaqpgrrkvleglqypfavtsygknlyytdwktnsviamdlaisk
emdtfhphkqtrlygitialsqc

SCOP Domain Coordinates for d1npea_:

Click to download the PDB-style file with coordinates for d1npea_.
(The format of our PDB-style files is described here.)

Timeline for d1npea_: