SCOPe 2.06: Domain d1npbe_: 1npb E:

Lineage for d1npbe_ (1npb E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)

7. Species Serratia marcescens [TaxId:615] [102871] (1 PDB entry)
   gene from transposon tn2921

8. Domain d1npbe_: 1npb E: [92030]
   complexed with gol, so4

Details for d1npbe_

PDB Entry: 1npb, 2.5 Å

PDB Description: Crystal structure of the fosfomycin resistance protein from transposon Tn2921

PDB Compounds: (E:) fosfomycin-resistance protein

SCOPe Domain Sequences for d1npbe_:

Sequence; same for both SEQRES and ATOM records:

>d1npbe_ d.32.1.2 (E:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]}
mlqslnhltlavsdlqksvtfwhellgltlharwntgayltcgdlwvclsydearqyvpp
qesdythyaftvaeedfeplsqrleqagvtiwkqnksegasfyfldpdghklelhvgsla
arlaacrekpyagmvfts

Timeline for d1npbe_:

• d1npbe_ first appeared in SCOP 1.67
  
• d1npbe_ appears in SCOPe 2.05
  
• d1npbe_ appears in SCOPe 2.07
  
• d1npbe_ appears in the current release, SCOPe 2.08