Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein Fosfomycin resistance protein A (FosA) [82630] (2 species) |
Species Serratia marcescens [TaxId:615] [102871] (1 PDB entry) gene from transposon tn2921 |
Domain d1npbd_: 1npb D: [92029] complexed with gol, so4 |
PDB Entry: 1npb (more details), 2.5 Å
SCOPe Domain Sequences for d1npbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npbd_ d.32.1.2 (D:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} mlqslnhltlavsdlqksvtfwhellgltlharwntgayltcgdlwvclsydearqyvpp qesdythyaftvaeedfeplsqrleqagvtiwkqnksegasfyfldpdghklelhvgsla arlaacrekpyagmvft
Timeline for d1npbd_: