Lineage for d1npbb_ (1npb B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410374Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 410375Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 410404Family d.32.1.2: Antibiotic resistance proteins [54598] (4 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 410429Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)
  7. 410441Species Serratia marcescens [TaxId:615] [102871] (1 PDB entry)
    gene from transposon tn2921
  8. 410443Domain d1npbb_: 1npb B: [92027]

Details for d1npbb_

PDB Entry: 1npb (more details), 2.5 Å

PDB Description: Crystal structure of the fosfomycin resistance protein from transposon Tn2921

SCOP Domain Sequences for d1npbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npbb_ d.32.1.2 (B:) Fosfomycin resistance protein A (FosA) {Serratia marcescens}
mlqslnhltlavsdlqksvtfwhellgltlharwntgayltcgdlwvclsydearqyvpp
qesdythyaftvaeedfeplsqrleqagvtiwkqnksegasfyfldpdghklelhvgsla
arlaacrekpyagmvftsd

SCOP Domain Coordinates for d1npbb_:

Click to download the PDB-style file with coordinates for d1npbb_.
(The format of our PDB-style files is described here.)

Timeline for d1npbb_: