Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries) |
Domain d1np8b_: 1np8 B: [92023] complexed with cd |
PDB Entry: 1np8 (more details), 2 Å
SCOPe Domain Sequences for d1np8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1np8b_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]} seeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsd ttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmii rrysdetgnmdfdnfisclvrldamfraf
Timeline for d1np8b_: