Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Glycosyl hydrolase family 5 xylanase, catalytic domain [102073] (1 species) overall domain organization is similar to the homologous glucosylceramidase |
Species Erwinia chrysanthemi [TaxId:556] [102074] (2 PDB entries) |
Domain d1nofa2: 1nof A:44-320 [92021] Other proteins in same PDB: d1nofa1 complexed with act |
PDB Entry: 1nof (more details), 1.42 Å
SCOPe Domain Sequences for d1nofa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} iqgfggmsgvgwindltteqintaygsgvgqiglsimrvridpdsskwniqlpsarqavs lgakimatpwsppaymksnnslinggrllpanysaytshlldfskymqtngaplyaisiq nepdwkpdyescewsgdefksylksqgskfgslkvivaeslgfnpaltdpvlkdsdasky vsiigghlygttpkpyplaqnagkqlwmtehyvdskqsannwtsaievgtelnasmvsny sayvwwyirrsyglltedgkvskrgyvmsqyarfvrp
Timeline for d1nofa2: