SCOPe 2.05: Domain d1nofa2: 1nof A:44-320

Lineage for d1nofa2 (1nof A:44-320)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Glycosyl hydrolase family 5 xylanase, catalytic domain [102073] (1 species)
   overall domain organization is similar to the homologous glucosylceramidase

7. Species Erwinia chrysanthemi [TaxId:556] [102074] (2 PDB entries)

8. Domain d1nofa2: 1nof A:44-320 [92021]
   Other proteins in same PDB: d1nofa1
   complexed with act

Details for d1nofa2

PDB Entry: 1nof, 1.42 Å

PDB Description: the first crystallographic structure of a xylanase from glycosyl hydrolase family 5: implications for catalysis

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1nofa2:

Sequence; same for both SEQRES and ATOM records:

>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]}
iqgfggmsgvgwindltteqintaygsgvgqiglsimrvridpdsskwniqlpsarqavs
lgakimatpwsppaymksnnslinggrllpanysaytshlldfskymqtngaplyaisiq
nepdwkpdyescewsgdefksylksqgskfgslkvivaeslgfnpaltdpvlkdsdasky
vsiigghlygttpkpyplaqnagkqlwmtehyvdskqsannwtsaievgtelnasmvsny
sayvwwyirrsyglltedgkvskrgyvmsqyarfvrp

Timeline for d1nofa2:

• d1nofa2 first appeared in SCOP 1.67
  
• d1nofa2 appears in SCOPe 2.04
  
• d1nofa2 appears in SCOPe 2.06
  
• d1nofa2 appears in the current release, SCOPe 2.08