Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Glycosyl hydrolase family 5 xylanase [101922] (1 species) |
Species Erwinia chrysanthemi [TaxId:556] [101923] (2 PDB entries) |
Domain d1nofa1: 1nof A:31-43,A:321-413 [92020] Other proteins in same PDB: d1nofa2 complexed with act |
PDB Entry: 1nof (more details), 1.42 Å
SCOPe Domain Sequences for d1nofa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nofa1 b.71.1.2 (A:31-43,A:321-413) Glycosyl hydrolase family 5 xylanase {Erwinia chrysanthemi [TaxId: 556]} dtvkidanvnyqiXgalriqatenpqsnvhltaykntdgkmvivavntndsdqmlslnis nanvtkfekystsaslnveyggssqvdssgkatvwlnplsvttfvsk
Timeline for d1nofa1: