Lineage for d1no8a_ (1no8 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908562Protein Nuclear factor Aly [102979] (1 species)
  7. 1908563Species Mouse (Mus musculus) [TaxId:10090] [102980] (1 PDB entry)
  8. 1908564Domain d1no8a_: 1no8 A: [92018]

Details for d1no8a_

PDB Entry: 1no8 (more details)

PDB Description: solution structure of the nuclear factor aly rbd domain
PDB Compounds: (A:) aly

SCOPe Domain Sequences for d1no8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}
gkllvsnldfgvsdadiqelfaefgtlkkaavhydrsgrslgtadvhferkadalkamkq
yngvpldgrpmniqlvts

SCOPe Domain Coordinates for d1no8a_:

Click to download the PDB-style file with coordinates for d1no8a_.
(The format of our PDB-style files is described here.)

Timeline for d1no8a_: