![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (4 proteins) insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold automatically mapped to Pfam PF01909 |
![]() | Protein Hypothetical protein HI0073 [102933] (1 species) nucleotide binding subunit of the HI0073/HI0074 nucleotidyltransferase (see 1jog) |
![]() | Species Haemophilus influenzae [TaxId:727] [102934] (1 PDB entry) |
![]() | Domain d1no5b_: 1no5 B: [92015] structural genomics complexed with gol, na, so4, zn |
PDB Entry: 1no5 (more details), 1.8 Å
SCOPe Domain Sequences for d1no5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1no5b_ d.218.1.5 (B:) Hypothetical protein HI0073 {Haemophilus influenzae [TaxId: 727]} faqldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldflard rlkeafsesdlpwrvdlldwattsedfreiirkvyvviqeke
Timeline for d1no5b_: