Lineage for d1no5b_ (1no5 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007215Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (4 proteins)
    insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold
    automatically mapped to Pfam PF01909
  6. 3007216Protein Hypothetical protein HI0073 [102933] (1 species)
    nucleotide binding subunit of the HI0073/HI0074 nucleotidyltransferase (see 1jog)
  7. 3007217Species Haemophilus influenzae [TaxId:727] [102934] (1 PDB entry)
  8. 3007219Domain d1no5b_: 1no5 B: [92015]
    structural genomics
    complexed with gol, na, so4, zn

Details for d1no5b_

PDB Entry: 1no5 (more details), 1.8 Å

PDB Description: Structure of HI0073 from Haemophilus influenzae, the nucleotide binding domain of the HI0073/HI0074 two protein nucleotidyl transferase.
PDB Compounds: (B:) Hypothetical protein HI0073

SCOPe Domain Sequences for d1no5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1no5b_ d.218.1.5 (B:) Hypothetical protein HI0073 {Haemophilus influenzae [TaxId: 727]}
faqldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldflard
rlkeafsesdlpwrvdlldwattsedfreiirkvyvviqeke

SCOPe Domain Coordinates for d1no5b_:

Click to download the PDB-style file with coordinates for d1no5b_.
(The format of our PDB-style files is described here.)

Timeline for d1no5b_: