SCOPe 2.08: Domain d1no5a_: 1no5 A:

Lineage for d1no5a_ (1no5 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (4 proteins)
   insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold
   automatically mapped to Pfam PF01909

6. Protein Hypothetical protein HI0073 [102933] (1 species)
   nucleotide binding subunit of the HI0073/HI0074 nucleotidyltransferase (see 1jog)

7. Species Haemophilus influenzae [TaxId:727] [102934] (1 PDB entry)

8. Domain d1no5a_: 1no5 A: [92014]
   structural genomics
   complexed with gol, na, so4, zn

Details for d1no5a_

PDB Entry: 1no5, 1.8 Å

PDB Description: Structure of HI0073 from Haemophilus influenzae, the nucleotide binding domain of the HI0073/HI0074 two protein nucleotidyl transferase.

PDB Compounds: (A:) Hypothetical protein HI0073

SCOPe Domain Sequences for d1no5a_:

Sequence; same for both SEQRES and ATOM records:

>d1no5a_ d.218.1.5 (A:) Hypothetical protein HI0073 {Haemophilus influenzae [TaxId: 727]}
qldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldflardrl
keafsesdlpwrvdlldwattsedfreiirkvyvviqeke

Timeline for d1no5a_:

• d1no5a_ first appeared in SCOP 1.67
  
• d1no5a_ appears in SCOPe 2.07