SCOPe 2.05: Domain d1nnxa_: 1nnx A:

Lineage for d1nnxa_ (1nnx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.10: Hypothetical protein YgiW [101756] (1 family)
   automatically mapped to Pfam PF04076

5. Family b.40.10.1: Hypothetical protein YgiW [101757] (1 protein)
   Pfam PF04076, Domain of unknown function DUF388

6. Protein Hypothetical protein YgiW [101758] (1 species)

7. Species Escherichia coli [TaxId:562] [101759] (1 PDB entry)

8. Domain d1nnxa_: 1nnx A: [92013]
   structural genomics
   complexed with so4

Details for d1nnxa_

PDB Entry: 1nnx, 1.45 Å

PDB Description: structure of the hypothetical protein ygiw from e. coli.

PDB Compounds: (A:) Protein ygiW

SCOPe Domain Sequences for d1nnxa_:

Sequence, based on SEQRES records:

>d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]}
qggfsgpsatqsqaggfqgpngsvttvesakslrddtwvtlrgniverisddlyvfkdas
gtinvdidhkrwngvtvtpkdtveiqgevdkdwnsveidvkqirkv

Sequence, based on observed residues (ATOM records):

>d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]}
qggfsgpsgsvttvesakslrddtwvtlrgniverisddlyvfkdasgtinvdidhkrwn
gvtvtpkdtveiqgevdkdwnsveidvkqirkv

Timeline for d1nnxa_:

• d1nnxa_ first appeared in SCOP 1.67
  
• d1nnxa_ appears in SCOPe 2.04
  
• d1nnxa_ appears in SCOPe 2.06
  
• d1nnxa_ appears in the current release, SCOPe 2.08