Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.7: Putative dsDNA mimic [102816] (1 family) elaborated with additional structures; some similarity to Uracil-DNA glycosylase (UGI) and Nuclease A (NuiA) inhibitors |
Family d.17.7.1: Putative dsDNA mimic [102817] (1 protein) Pfam 04269, DUF440 |
Protein Hypothetical protein HI1450 [102818] (1 species) putative dsDNA mimic |
Species Haemophilus influenzae [TaxId:727] [102819] (1 PDB entry) |
Domain d1nnva_: 1nnv A: [92012] structural genomics |
PDB Entry: 1nnv (more details)
SCOP Domain Sequences for d1nnva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnva_ d.17.7.1 (A:) Hypothetical protein HI1450 {Haemophilus influenzae} mtteikkldpdtaidiaydiflemagenldpadillfnlqfeerggvefvetaddweeei gvlidpeeyaevwvglvneqdemddvfakflishreedrefhviwkk
Timeline for d1nnva_: